PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015899771.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 503aa    MW: 55484.9 Da    PI: 6.5007
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015899771.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-39119177260
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                     ++k+l+cprC+s++tkfCy+nny+++qPryfCk+C+ryWt+GG++rnvP+G+grrknk+
  XP_015899771.1 119 PDKILPCPRCNSSDTKFCYFNNYNVNQPRYFCKNCQRYWTAGGTMRNVPIGAGRRKNKH 177
                     7899*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29111176IPR003851Zinc finger, Dof-type
PfamPF027019.4E-32121177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.64123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MSESNSNGDN IINCTTDQAI KLFGRTIPVP EIQISDNSDS ASRIPPTTQL MESCGDISKT  60
EVDSPCAESF REPRKLLGLS NCKEQKNSLQ VNEAQENTKP VEEKVDGNCS EQEQILKKPD  120
KILPCPRCNS SDTKFCYFNN YNVNQPRYFC KNCQRYWTAG GTMRNVPIGA GRRKNKHLAP  180
QYHQIMVSTD GVPPAGLETS DASSPQVFSC SESKPSFNPS NGNGRVIKFG PEAPLCESME  240
NVLNLQDYKR YVEMRFVNSG ENGPERSCGS SMTLTSDRRS ELPENVLPSE KVGLQEYSQE  300
HNSMLHPMHY PVPPLVFSWN PASSSSQYSQ GIFVPNGGPN QAQWNQPPML TVPGHSSMPF  360
PFLPASYWGC IPSWASGRGS VSLTESINCP SPSSSNSNGG CSGNGSPTLG KHSRDANLMD  420
EDKLDKSILV PKTIRLDKPN EASKIPKWST LEIKPDQNES VLKGNIFRTL EHKTEGKDHL  480
YSSPIMEANN VTLSCSHTFQ QST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899771.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A067KTT61e-167A0A067KTT6_JATCU; Uncharacterized protein
STRINGPOPTR_0013s06290.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-58cycling DOF factor 2